Pay in 4 interest-free payments of $5.82 Learn more
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Discovery and characterization of a new class of NAD(+)-independent SIRT1 activators [PMID: 38971269] Laboratory literature summary: Discovery and characterization of a new class of NAD(+)-independent SIRT1 activators
Getting to a healthy weight is also good for the heart, joints, liver, and so on
Product Specifications CAS Number : 1415456-99-3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (disulfide bridge Cys3Cys8
If you get in touch with our intake counselors, we can help you begin to navigate and verify your Blue Cross Blue Shield insurance benefits today or determine which other providers we accept
US$ 23.86
US$ 25.73
US$ 21.38
US$ 23.56
US$ 29.94
US$ 21.61
US$ 29.63
